HPA020137

DDX25 antibody from Sigma-Aldrich
GRTH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020137
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020137, RRID:AB_1847552
Product name
Anti-DDX25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020137
Antibody type
Polyclonal
Antigen
ATP-dependent RNA helicase DDX25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINED
DEEDVVDLAANSLLNKLIHQSLVESSHRVEVLQKD
PSSP
Storage
-20C
Provider Type Product Number
- No reagents -