HPA003485

FOXN2 antibody from Atlas Antibodies
HTLF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003485
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003485, RRID:AB_1078905
Product name
Anti-FOXN2
Provider product page
Atlas Antibodies - HPA003485
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLI
QALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNL
KESDIDAAAAMMLLNTSIEQGILECEKPLPLKTAL
QKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHN
YSA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -