HPA003485

FOXN2 antibody from Sigma-Aldrich
HTLF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003485
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003485, RRID:AB_1078905
Product name
Anti-FOXN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003485
Antibody type
Polyclonal
Antigen
Forkhead box protein N2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLI
QALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNL
KESDIDAAAAMMLLNTSIEQGILECEKPLPLKTAL
QKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHN
YSA
Storage
-20C
Provider Type Product Number
- No reagents -