ABIN567194

NR1H2 antibody from antibodies-online
LXR-b, LXRb, NER, NER-I, RIP15, UNR

Antibody data

Product number
ABIN567194
Provider
antibodies-online
Product name
anti-Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2) (N-Term) antibody
Provider product page
antibodies-online - ABIN567194
Antibody type
Polyclonal
Antigen
The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the N terminal of human NR1H2
Reactivity
Human
Host
Rabbit
Antigen sequence
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGP
EPWPG GPDPDVPGTD
Vial size
50 µg
Provider Type Product Number
- No reagents -