Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309919 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nuclear Receptor Subfamily 1, Group H, Member 2 (NR1H2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the N terminal of human NR1H2
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGT
DEASS ACSTDWVIPD- Vial size
- 0.1 mg
Submitted references The reverse cholesterol transport system as a potential mediator of luteolysis in the primate corpus luteum.
A novel principle for partial agonism of liver X receptor ligands. Competitive recruitment of activators and repressors.
Bogan RL, Hennebold JD
Reproduction (Cambridge, England) 2010 Jan;139(1):163-76
Reproduction (Cambridge, England) 2010 Jan;139(1):163-76
A novel principle for partial agonism of liver X receptor ligands. Competitive recruitment of activators and repressors.
Albers M, Blume B, Schlueter T, Wright MB, Kober I, Kremoser C, Deuschle U, Koegl M
The Journal of biological chemistry 2006 Feb 24;281(8):4920-30
The Journal of biological chemistry 2006 Feb 24;281(8):4920-30
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting