HPA021332

NQO2 antibody from Atlas Antibodies
DHQV, DIA6, NMOR2, QR2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021332
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021332, RRID:AB_1854601
Product name
Anti-NQO2
Provider product page
Atlas Antibodies - HPA021332
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGC
TVTVSDLYAMNLEPRATDKDITGTLSNPEVFNYGV
ETHEAYKQRSLASDITDEQKKVREADLVIFQFPLY
WFSVPA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -