HPA021283

NQO2 antibody from Sigma-Aldrich
DHQV, DIA6, NMOR2, QR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021283
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021283, RRID:AB_1854600
Product name
Anti-NQO2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021283
Antibody type
Polyclonal
Antigen
Ribosyldihydronicotinamide dehydrogenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKGWMDRVLCQGFAFDIPGFYDSGLLQGKLALLSV
TTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGF
KVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWK
EEPIPCTAHWHFGQ
Storage
-20C
Provider Type Product Number
- No reagents -