HPA004174

RARB antibody from Atlas Antibodies
HAP, NR1B2, RRB2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004174
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004174, RRID:AB_1079744
Product name
Anti-RARB
Provider product page
Atlas Antibodies - HPA004174
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLSVSPGQILDFYTASPSSCMLQEKALKACFSGLT
QTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPR
VYKPCFVCQDKSSGYHYGV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -