HPA004174

RARB antibody from Atlas Antibodies
HAP, NR1B2, RRB2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004174
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004174, RRID:AB_888836
Product name
Anti-RARB
Provider product page
Atlas Antibodies - HPA004174
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLSVSPGQILDFYTASPSSCMLQEKALKACFSGLT
QTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPR
VYKPCFVCQDKSSGYHYGV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -