Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004174 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004174, RRID:AB_1079744
- Product name
- Anti-RARB
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VLSVSPGQILDFYTASPSSCMLQEKALKACFSGLT
QTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPR
VYKPCFVCQDKSSGYHYGV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma
Seidensaal K, Nollert A, Feige A, Muller M, Fleming T, Gunkel N, Zaoui K, Grabe N, Weichert W, Weber K, Plinkert P, Simon C, Hess J
Molecular Cancer 2015 December;14(1)
Molecular Cancer 2015 December;14(1)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and rARB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402510).
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-RARB antibody. Corresponding RARB RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN