HPA004174

RARB antibody from Sigma-Aldrich
HAP, NR1B2, RRB2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004174
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004174, RRID:AB_1079744
Product name
Anti-RARB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004174
Antibody type
Polyclonal
Antigen
Retinoic acid receptor beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLSVSPGQILDFYTASPSSCMLQEKALKACFSGLT
QTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPR
VYKPCFVCQDKSSGYHYGV
Storage
-20C
Provider Type Product Number
- No reagents -