Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109571 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 295 (ZNF295) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF295 antibody: synthetic peptide directed towards the N terminal of human ZNF295
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
DQKFRAHKNVLAASSEYFQSLFTNKENESQTVFQL
DFCEPDAFDNVLNYI- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
Cell 2006 Nov 3;127(3):635-48
Cell 2006 Nov 3;127(3):635-48
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Muscle; WB Suggested Anti-ZNF295 Antibody Titration: 0.2-1 ug/ml. Positive Control: Human Muscle; ZNF295 antibody - N-terminal region (AP42134PU-N) in Human Muscle cells using Western Blot
