HPA024655

ZBTB21 antibody from Sigma-Aldrich
KIAA1227, ZNF295
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024655
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024655, RRID:AB_1859171
Product name
Anti-ZNF295 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024655
Antibody type
Polyclonal
Antigen
Zinc finger protein 295 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPEPNKVNHIVTTKDDNVFSDSSEQVNFDSEDSSC
LPEDLSLSKQLKIQVKEEPVEEAEEEAPEASTAPK
EAGPSKEASLWPCEKCGKMFTVHKQLERHQELLCS
VKPFICHVCNKAFRTNFRLWSHFQSHMSQASEESA
HKESEVCP
Storage
-20C
Provider Type Product Number
- No reagents -