H00000861-M18

RUNX1 antibody from Abnova Corporation
AML1, AMLCR1, CBFA2, PEBP2A2
No application information provided.

Antibody data

Product number
H00000861-M18
Provider
Abnova Corporation
Product name
RUNX1 monoclonal antibody (M18), clone 3D7
Provider product page
Abnova Corporation - H00000861-M18
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RUNX1.
Antigen sequence
RYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGAS
AGSYQFSMVGGERSPPRILPPCTNASTGSALLNPS
LPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY
Isotype
IgG
Antibody clone number
3D7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -