Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000861-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000861-M01, RRID:AB_581883
- Product name
- RUNX1 monoclonal antibody (M01), clone 3A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RUNX1.
- Antigen sequence
RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTR
QIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGR
ASGMTTLSAELSSRLSTAPDLTAFSDPRQFP- Isotype
- IgG
- Antibody clone number
- 3A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The RUNX1 transcription factor is expressed in serous epithelial ovarian carcinoma and contributes to cell proliferation, migration and invasion.
Keita M, Bachvarova M, Morin C, Plante M, Gregoire J, Renaud MC, Sebastianelli A, Trinh XB, Bachvarov D
Cell cycle (Georgetown, Tex.) 2013 Mar 15;12(6):972-86
Cell cycle (Georgetown, Tex.) 2013 Mar 15;12(6):972-86
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol