Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000861-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000861-M02, RRID:AB_565538
- Product name
- RUNX1 monoclonal antibody (M02), clone 3A1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RUNX1.
- Antigen sequence
RVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTR
QIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGR
ASGMTTLSAELSSRLSTAPDLTAFSDPRQFP- Isotype
- IgG
- Antibody clone number
- 3A1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RUNX1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RUNX1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CDK6 and RUNX1. HeLa cells were stained with anti-CDK6 rabbit purified polyclonal 1:1200 and anti-RUNX1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)