Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183603 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Runt-Related Transcription Factor 1 (RUNX1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RUNX1 antibody: synthetic peptide directed towards the N terminal of human RUNX1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
KMPAAPRGPAQGEAAARTRSRDASTSRRFTPPSTA
LSPGK MSEALPLGAP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression of the human acute myeloid leukemia gene AML1 is regulated by two promoter regions.
Ghozi MC, Bernstein Y, Negreanu V, Levanon D, Groner Y
Proceedings of the National Academy of Sciences of the United States of America 1996 Mar 5;93(5):1935-40
Proceedings of the National Academy of Sciences of the United States of America 1996 Mar 5;93(5):1935-40
No comments: Submit comment
No validations: Submit validation data