HPA004176

RUNX1 antibody from Sigma-Aldrich
AML1, AMLCR1, CBFA2, PEBP2A2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004176
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004176, RRID:AB_1078412
Product name
Anti-RUNX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004176
Antibody type
Polyclonal
Antigen
Runt-related transcription factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPS
VHPATPISPGRASGMTTLSAELSSRLSTAPDLTAF
SDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGI
Storage
-20C
Provider Type Product Number
- No reagents -