Antibody data

Product number
ABIN504666
Provider
antibodies-online
Product name
anti-Friend Leukemia Virus Integration 1 (FLI1) antibody
Provider product page
antibodies-online - ABIN504666
Antibody type
Polyclonal
Antigen
The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the middle region of human FLI1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAH
QQKVN FVPPHPSSMP
Vial size
50 μg
Storage
Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Provider Type Product Number
- No reagents -