Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504666 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Friend Leukemia Virus Integration 1 (FLI1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the middle region of human FLI1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAH
QQKVN FVPPHPSSMP- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
Miyagawa H, Yamai M, Sakaguchi D, Kiyohara C, Tsukamoto H, Kimoto Y, Nakamura T, Lee JH, Tsai CY, Chiang BL, Shimoda T, Harada M, Tahira T, Hayashi K, Horiuchi T
Rheumatology (Oxford, England) 2008 Feb;47(2):158-64
Rheumatology (Oxford, England) 2008 Feb;47(2):158-64
No comments: Submit comment
No validations: Submit validation data