HPA005624

SCYL3 antibody from Sigma-Aldrich
PACE-1, PACE1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005624
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005624, RRID:AB_1854916
Product name
Anti-SCYL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005624
Antibody type
Polyclonal
Antigen
Protein-associating with the carboxyl-terminal domain of ezrin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDWSEPEEPENQTVNIQIWPREPCDDVKSQCTTLD
VEESSWDDCEPSSLDTKVNPGGGITATKPVTSAEQ
KPIPALLSLTEESMPWKSSLPQKISLVQRGDDADQ
IEPPKVSSQERPLKVPSELGLGEE
Storage
-20C
Provider Type Product Number
- No reagents -