Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA025229 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-ELTD1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGT
VCIENVNANCHLDNVCIAANINKTLTKIRSIKEPV
ALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGY
KNNTIS- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references ELTD1 deletion reduces vascular abnormality and improves T-cell recruitment after PD-1 blockade in glioma
ADGRL4/ELTD1 Expression in Breast Cancer Cells Induces Vascular Normalization and Immune Suppression
ADGRL4/ELTD1 Silencing in Endothelial Cells Induces ACLY and SLC25A1 and Alters the Cellular Metabolic Profile
Epidermal growth factor, latrophilin, and seven transmembrane domain-containing protein 1 marker, a novel angiogenesis marker
Transcriptional profiling of human glioblastoma vessels indicates a key role of VEGF‐A and TGFβ2 in vascular abnormalization
Huang H, Georganaki M, Conze L, Laviña B, van Hooren L, Vemuri K, van de Walle T, Ramachandran M, Zhang L, Pontén F, Bergqvist M, Smits A, Betsholtz C, Dejana E, Magnusson P, He L, Lugano R, Dimberg A
Neuro-Oncology 2022;24(3):398-411
Neuro-Oncology 2022;24(3):398-411
ADGRL4/ELTD1 Expression in Breast Cancer Cells Induces Vascular Normalization and Immune Suppression
Sheldon H, Bridges E, Silva I, Masiero M, Favara D, Wang D, Leek R, Snell C, Roxanis I, Kreuzer M, Gileadi U, Buffa F, Banham A, Harris A
Molecular Cancer Research 2021;19(11):1957-1969
Molecular Cancer Research 2021;19(11):1957-1969
ADGRL4/ELTD1 Silencing in Endothelial Cells Induces ACLY and SLC25A1 and Alters the Cellular Metabolic Profile
Favara D, Zois C, Haider S, Pires E, Sheldon H, McCullagh J, Banham A, Harris A
Metabolites 2019;9(12):287
Metabolites 2019;9(12):287
Epidermal growth factor, latrophilin, and seven transmembrane domain-containing protein 1 marker, a novel angiogenesis marker
Dricu A, Serban F, Artene S, Georgescu A, Purcaru S, Tache D, Alexandru O
OncoTargets and Therapy 2015
OncoTargets and Therapy 2015
Transcriptional profiling of human glioblastoma vessels indicates a key role of VEGF‐A and TGFβ2 in vascular abnormalization
Dieterich L, Mellberg S, Langenkamp E, Zhang L, Zieba A, Salomäki H, Teichert M, Huang H, Edqvist P, Kraus T, Augustin H, Olofsson T, Larsson E, Söderberg O, Molema G, Pontén F, Georgii‐Hemming P, Alafuzoff I, Dimberg A
The Journal of Pathology 2012;228(3):378-390
The Journal of Pathology 2012;228(3):378-390
No comments: Submit comment
No validations: Submit validation data