HPA025229

ADGRL4 antibody from Sigma-Aldrich
ELTD1, ETL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025229
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025229, RRID:AB_10602493
Product name
Anti-ELTD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025229
Antibody type
Polyclonal
Antigen
EGF, latrophilin and seven transmembrane domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGT
VCIENVNANCHLDNVCIAANINKTLTKIRSIKEPV
ALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGY
KNNTIS
Storage
-20C
Provider Type Product Number
- No reagents -