Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449810 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 70 (ZNF70) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide directed towards the C-terminal region of human ZNF70
- Description
- Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
GKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGS
SHLIRHQKIHSGEKL- Epitope
- C-Term
- Vial size
- 0.1 mg
- Concentration
- 1.0 mg/mL after reconstitution
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or (in aliquots) at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-ZNF70 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate; ZNF70 antibody - C-terminal region (AP42658PU-N) in Human HepG2 cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Stomach; ZNF70 antibody - C-terminal region (AP42658PU-N) in Human Stomach cells using Immunohistochemistry