HPA018821

ZNF70 antibody from Atlas Antibodies
Cos17, MGC48959
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018821
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018821, RRID:AB_1859423
Product name
Anti-ZNF70
Provider product page
Atlas Antibodies - HPA018821
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCA
ETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSS
HLLRHLVIHTGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -