HPA001761

SEMA3G antibody from Sigma-Aldrich
FLJ00014, sem2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001761
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001761, RRID:AB_1079902
Product name
Anti-SEMA3G antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001761
Antibody type
Polyclonal
Antigen
Semaphorin-3G precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRWLLQRPGDEGPDQVKTDERVLHTERGLLFRRLS
RFDAGTYTCTTLEHGFSQTVVRLALVVIVASQLDN
LFPPEPKPEEPPARGGLASTPPKAWYKDILQLIG
Storage
-20C
Provider Type Product Number
- No reagents -