HPA019494

C22orf15 antibody from Sigma-Aldrich
FLJ36561, N27C7-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019494
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019494, RRID:AB_1848904
Product name
Anti-C22orf15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019494
Antibody type
Polyclonal
Antigen
Uncharacterized protein C22orf15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KERAIYVLVRIISKVAQEGEDMASTRYESLLENLD
DHYPELAEELRRLSGLSSVGHNWRKRMGTRRGRHE
QSPTSR
Storage
-20C
Provider Type Product Number
- No reagents -