HPA001762

VIM antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001762
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001762, RRID:AB_611878
Product name
Anti-VIM
Provider product page
Atlas Antibodies - HPA001762
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGD
LYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIM
RLREKLQEEMLQREEAENTLQSFRQDVDNASLARL
DLERKVES
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -