HPA001762

VIM antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001762
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001762, RRID:AB_1080568
Product name
Anti-VIM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001762
Antibody type
Polyclonal
Antigen
Vimentin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGD
LYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIM
RLREKLQEEMLQREEAENTLQSFRQDVDNASLARL
DLERKVES
Storage
-20C
Provider Type Product Number
- No reagents -