Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20304 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20304, RRID:AB_10965880
- Product name
- LRRC7 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human LRRC7.
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
RGDEDFQSDSDSFNPTLWEEQRQQRMTVAFEFEDK
KEDDENAGKVKDLSCQAPWERGQRGITLQPARLSG
DCCTPWARCDQQIQDMPVPQNDPQLAWGCISGLQQ
ERSMCTPLPVAAQSTTLPSLSGRQVE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of cell lysates with LRRC7 polyclonal antibody (Cat # PAB20304) at 1:250-1:500 dilution.Lane 1 : NIH/3T3Lane 2 : NBT-II
- Validation comment
- Western Blot (Cell lysate)
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node with LRRC7 polyclonal antibody (Cat # PAB20304) shows strong cytoplasmic positivity in lymphoid cells outside reaction centra at 1:500-1:1000 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)