HPA002314

LRRC7 antibody from Sigma-Aldrich
densin-180, KIAA1365
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002314
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002314, RRID:AB_1079281
Product name
Anti-LRRC7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002314
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQLERLDLGNNEFGELPEVLDQIQNLRELWMDNNA
LQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCE
ALEDLLLSSNMLQQLPDSIGLLKKLTTLKVDDNQL
TMLPNTIGNLSLLEEFDCSCNELESL
Storage
-20C
Provider Type Product Number
- No reagents -