HPA005625

LRRC7 antibody from MilliporeSigma / Merck KGaA
densin-180, KIAA1365
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005625
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA005625, RRID:AB_1853340
Product name
Anti-LRRC7 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA005625
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RGDEDFQSDSDSFNPTLWEEQRQQRMTVAFEFEDK
KEDDENAGKVKDLSCQAPWERGQRGITLQPARLSG
DCCTPWARCDQQIQDMPVPQNDPQLAWGCISGLQQ
ERSMCTPLPVAAQSTTLPSLSGRQVE
Storage
-20C
Provider Type Product Number
- No reagents -