HPA027138

SYDE2 antibody from MilliporeSigma / Merck KGaA
FLJ13815
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027138
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027138, RRID:AB_1857686
Product name
Anti-SYDE2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027138
Antibody type
Polyclonal
Antigen
Rho GTPase-activating protein SYDE2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSHLSISPVSLPKHQLSQSFLKSSKEYCTYVVCNA
TNSSLSKNCALDFNEENDADDEGEIWYNPIPEDDD
LGISSALSFGEADSAVLKLPAVNLSMLS
Storage
-20C
Provider Type Product Number
- No reagents -