HPA023274

TANC2 antibody from Sigma-Aldrich
DKFZP564D166, FLJ10215, FLJ11824, KIAA1148, KIAA1636, rols, ROLSA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023274
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023274, RRID:AB_2199727
Product name
Anti-TANC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023274
Antibody type
Polyclonal
Antigen
Protein TANC2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGN
LPQPESFSPPSSISNIAFYNKTNNAQNGHLLEDDY
YSPHGMLANGSRGDLLERVSQASSYPDVKVARTLP
VAQAYQDNLYRQLSRDSRQGQ
Storage
-20C
Provider Type Product Number
- No reagents -