Antibody data

Product number
H00010741-M03A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010741-M03A, RRID:AB_1237843
Product name
RBBP9 monoclonal antibody (M03A), clone 3H4
Provider product page
Abnova Corporation - H00010741-M03A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RBBP9.
Antigen sequence
MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIP
GFQCLAKNMPDPITARESIWLPFMETELHCDEKTI
IIGHSSGAIAAMRYAETHRVYAIVLVSAYTSDLGD
ENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPF
LPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELI
TVVKSLLKVPA
Isotype
IgM
Antibody clone number
3H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -