HPA015830

RBBP9 antibody from MilliporeSigma / Merck KGaA
Bog
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015830
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015830, RRID:AB_1845410
Product name
Anti-RBBP9 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015830
Antibody type
Polyclonal
Antigen
Putative hydrolase RBBP9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIP
GFQCLAKNMPDPITARESIWLPFMETELHCDEKTI
IIGHSSGAIAAMRYAETHRVYAIVLVSAYTSDLGD
ENERAS
Storage
-20C
Provider Type Product Number
- No reagents -