HPA005923

RIPOR1 antibody from Sigma-Aldrich
FAM65A, FLJ13725
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005923
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005923, RRID:AB_1078809
Product name
Anti-FAM65A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005923
Antibody type
Polyclonal
Antigen
family with sequence similarity 65, member A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HALESFSFLNEDEDEDNDVPGDRPPSSPEAGAEDS
IDSPSARPLSTGCPALDAALVRHLYHCSRLLLKLG
TFGPLRCQEAWALERLLREARVLEAVCEFSRRWEI
PASSAQEVVQFS
Storage
-20C
Provider Type Product Number
- No reagents -