HPA014785

TRPM1 antibody from Sigma-Aldrich
CSNB1C, LTRPC1, MLSN1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014785
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014785, RRID:AB_1858366
Product name
Anti-TRPM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014785
Antibody type
Polyclonal
Antigen
Transient receptor potential cation channel subfamily M member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGGVNQDVEYSSITDQQLTTEWQCQVQKITRSHST
DIPYIVSEAAVQAEHKEQFADMQDEHHVAEAIPRI
PRLSLTITDRNGMENLLSVKPDQTLGFPSLRSKSL
HGHPRNVKSIQGKL
Storage
-20C
Provider Type Product Number
- No reagents -