Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014785 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TRPM1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VGGVNQDVEYSSITDQQLTTEWQCQVQKITRSHST
DIPYIVSEAAVQAEHKEQFADMQDEHHVAEAIPRI
PRLSLTITDRNGMENLLSVKPDQTLGFPSLRSKSL
HGHPRNVKSIQGKL- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Identification and characterization of novel TRPM1 autoantibodies from serum of patients with melanoma-associated retinopathy
Alterations in Kainate Receptor and TRPM1 Localization in Bipolar Cells after Retinal Photoreceptor Degeneration
Serum TRPM1 Autoantibodies from Melanoma Associated Retinopathy Patients Enter Retinal ON-Bipolar Cells and Attenuate the Electroretinogram in Mice
Autoantibodies in Melanoma-Associated Retinopathy Target TRPM1 Cation Channels of Retinal ON Bipolar Cells
Stieger K, Varin J, Reynolds M, Bouzidi N, Tick S, Wohlschlegel J, Becquart O, Michiels C, Dereure O, Duvoisin R, Morgans C, Sahel J, Samaran Q, Guillot B, Pulido J, Audo I, Zeitz C
PLOS ONE 2020;15(4):e0231750
PLOS ONE 2020;15(4):e0231750
Alterations in Kainate Receptor and TRPM1 Localization in Bipolar Cells after Retinal Photoreceptor Degeneration
Gayet-Primo J, Puthussery T
Frontiers in Cellular Neuroscience 2015;9
Frontiers in Cellular Neuroscience 2015;9
Serum TRPM1 Autoantibodies from Melanoma Associated Retinopathy Patients Enter Retinal ON-Bipolar Cells and Attenuate the Electroretinogram in Mice
Fletcher E, Xiong W, Duvoisin R, Adamus G, Jeffrey B, Gellman C, Morgans C
PLoS ONE 2013;8(8):e69506
PLoS ONE 2013;8(8):e69506
Autoantibodies in Melanoma-Associated Retinopathy Target TRPM1 Cation Channels of Retinal ON Bipolar Cells
Dhingra A, Fina M, Neinstein A, Ramsey D, Xu Y, Fishman G, Alexander K, Qian H, Peachey N, Gregg R, Vardi N
The Journal of Neuroscience 2011;31(11):3962-3967
The Journal of Neuroscience 2011;31(11):3962-3967
No comments: Submit comment
No validations: Submit validation data