HPA001767

CDH3 antibody from Sigma-Aldrich
CDHP, PCAD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001767
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001767, RRID:AB_1078376
Product name
Anti-CDH3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001767
Antibody type
Polyclonal
Antigen
Cadherin-3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVIS
SGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEI
LDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTD
LDAPNSPAWRATYLIMGGDDGDHFTITTHPE
Storage
-20C
Provider Type Product Number
- No reagents -