HPA022962

DCAF7 antibody from Sigma-Aldrich
HAN11, SWAN-1, WDR68
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022962
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022962, RRID:AB_1858821
Product name
Anti-WDR68 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022962
Antibody type
Polyclonal
Antigen
WD repeat-containing protein 68 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YPDLLATSGDYLRVWRVGETETRLECLLNNNKNSD
FCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETG
QVLGRVNLVSGHVKTQ
Storage
-20C
Provider Type Product Number
- No reagents -