HPA001672

SLC9A3R2 antibody from Atlas Antibodies
E3KARP, NHERF-2, SIP-1, TKA-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001672
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001672, RRID:AB_1080017
Product name
Anti-SLC9A3R2
Provider product page
Atlas Antibodies - HPA001672
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVD
QETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPD
WAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQ
GYGFNLH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -