HPA001672

SLC9A3R2 antibody from Atlas Antibodies
E3KARP, NHERF-2, SIP-1, TKA-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001672
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001672, RRID:AB_611794
Product name
Anti-SLC9A3R2
Provider product page
Atlas Antibodies - HPA001672
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVD
QETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPD
WAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQ
GYGFNLH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -