HPA001672

SLC9A3R2 antibody from Sigma-Aldrich
E3KARP, NHERF-2, SIP-1, TKA-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001672
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001672, RRID:AB_1080017
Product name
Anti-SLC9A3R2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001672
Antibody type
Polyclonal
Antigen
Na+/H+ exchange regulatory cofactor NHE-RF2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVD
QETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPD
WAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQ
GYGFNLH
Storage
-20C
Provider Type Product Number
- No reagents -