Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006603-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006603-M02, RRID:AB_894264
- Product name
- SMARCD2 monoclonal antibody (M02), clone 2B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SMARCD2.
- Antigen sequence
RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGN
PEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELE
QVLGIRL- Isotype
- IgG
- Antibody clone number
- 2B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in NIH/3T3(Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to SMARCD2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol