HPA001674

GLCCI1 antibody from Sigma-Aldrich
FAM117C, GIG18, TSSN1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001674
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001674, RRID:AB_1078971
Product name
Anti-GLCCI1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001674
Antibody type
Polyclonal
Antigen
Glucocorticoid-induced transcript 1 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPLSNISVPKSSVSRVPCNVEGISPELEKVFIKEN
NGKEEVSKPLDIPDGRRAPLPAHYRSSSTRSIDTQ
TPSVQERSSSCSSHSPCVSPFCPPESQDGSPCSTE
DLLYDRDKDSGSSSPLPKYASSPKPNNSYMFKRE
Storage
-20C
Provider Type Product Number
- No reagents -