HPA005623

MEST antibody from Sigma-Aldrich
PEG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005623
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005623, RRID:AB_1079364
Product name
Anti-MEST antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005623
Antibody type
Polyclonal
Antigen
Mesoderm-specific transcript homolog protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSWKSSGKFFTYKGLRIFYQDSVGVVGSPEIVVLL
HGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFS
DKPRPHHYSIFEQASIVEALLRHLGLQNRRINLLS
HDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGI
FPETHRPL
Storage
-20C
Provider Type Product Number
- No reagents -