HPA007991

ARHGEF17 antibody from Sigma-Aldrich
KIAA0337, p164-RhoGEF, TEM4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007991
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007991, RRID:AB_1845005
Product name
Anti-ARHGEF17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007991
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor 17 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VYQREAGHFWDPQNFKSVTLGTQGSPITKMVSVGG
RLWCGCQNRVLVLSPDTLQLEHMFYVGQDSSRCVA
CMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDV
TPPVHRMLAGSDAIIRQHKAACLRITALLVCEELL
W
Storage
-20C
Provider Type Product Number
- No reagents -