Antibody data

Product number
H00023410-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023410-M09, RRID:AB_1580642
Product name
SIRT3 monoclonal antibody (M09), clone 1A4
Provider product page
Abnova Corporation - H00023410-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SIRT3.
Antigen sequence
PLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLT
EAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDV
VHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Isotype
IgG
Antibody clone number
1A4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -