HPA026809

SIRT3 antibody from Sigma-Aldrich
SIR2L3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026809
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026809, RRID:AB_10601160
Product name
Anti-SIRT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026809
Antibody type
Polyclonal
Antigen
sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FSVGASSVVGSGGSSDKGKLSLQDVAELIRARACQ
RVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDL
PYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNV
THYFLRLLHDKGLLLRLYT
Storage
-20C
Provider Type Product Number
- No reagents -