AV36043

ZNF665 antibody from Sigma-Aldrich
FLJ14345
No application information provided.

Antibody data

Product number
AV36043
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV36043, RRID:AB_1859400
Product name
Anti-ZNF665 (AB2) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV36043
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF665 with an internal ID of P07353
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
CDECGKVFSQNSRLTSHKRIHTGEKPYQCNKCGKA
FTVRSNLTIHQVIHT
Storage
-20C
Provider Type Product Number
- No reagents -