Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184218 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the N terminal of human CHRNA7
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFS
LSLLQ IMDVDEKNQV- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Soluble, oligomeric, and ligand-binding extracellular domain of the human alpha7 acetylcholine receptor expressed in yeast: replacement of the hydrophobic cysteine loop by the hydrophilic loop of the ACh-binding protein enhances protein solubility.
Avramopoulou V, Mamalaki A, Tzartos SJ
The Journal of biological chemistry 2004 Sep 10;279(37):38287-93
The Journal of biological chemistry 2004 Sep 10;279(37):38287-93
No comments: Submit comment
No validations: Submit validation data