Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28547 - Provider product page

- Provider
- Abnova Corporation
- Product name
- PLSCR4 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant PLSCR4.
- Antigen sequence
PQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPI
TWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLE
MMTCFETNNRYDIKNNSDQMVYIVTEDTDDFTRNA
YRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCC
PSA- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with PLSCR4 polyclonal antibody (PAB28547) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of A-431 with PLSCR4 polyclonal antibody (Cat # PAB28547) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human adrenal gland with PLSCR4 polyclonal antibody (Cat # PAB28547) shows strong cytoplasmic and membranous positivity in cortical cells at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)