HPA002276

PLSCR4 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002276
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002276, RRID:AB_1855479
Product name
Anti-PLSCR4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002276
Antibody type
Polyclonal
Antigen
Phospholipid scramblase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPI
TWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLE
MMTCFETNNRYDIKNNSDQMVYIVTEDTDDFTRNA
YRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCC
PSA
Storage
-20C
Provider Type Product Number
- No reagents -